PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj3g3v2924230.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family TCP
Protein Properties Length: 119aa    MW: 13345.6 Da    PI: 9.9131
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj3g3v2924230.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP293.5e-094889849
              TCP  8 hskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktie 49
                     + ++hTkv+ R     l++   ar+F+L+ eLGf + ++tie
  Lj3g3v2924230.1 48 NEDRHTKVNKRESCATLPSVRVARIFQLTCELGFSSHGETIE 89
                     579**************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036346.4E-64889IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 119 aa     Download sequence    Send to blast
MSSEKTSLKR VLSSSSSTFS TNQPKYMMSE IPLPLKATNT KLHPLKGNED RHTKVNKRES  60
CATLPSVRVA RIFQLTCELG FSSHGETIET RLPLRATYTK LILCYFAINV CCLSLPTHL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014522352.15e-18PREDICTED: transcription factor TCP15
TrEMBLA0A151R4T27e-20A0A151R4T2_CAJCA; Transcription factor TCP21
STRINGGLYMA11G20201.13e-17(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38193363
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37000.14e-11TCP family protein